PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 277aa    MW: 29415.4 Da    PI: 10.4967
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_326.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.9e-41146222177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cq+egC+adls ak+yhrrhkvCe h+ka+ v+++g++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  MLOC_326.1 146 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASLVAANGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 222
                 6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-35139208IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.479144221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-39145224IPR004333Transcription factor, SBP-box
PfamPF031103.1E-31147220IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVQAGGGGGG GQRHLQGAMM YDNLDFAAAF GQFQDAPHHQ MLGMPPNGSG AGGLVPMAPP  60
PMPMPGMQLQ MPPMAMHGHG DVYPTLGMVK REGGGAGDAG RIGLNLGRRT YFSPGDMMAV  120
DRLLMRSRLG GVFGLGFGGA HHQPPRCQAE GCKADLSGAK HYHRRHKVCE YHAKASLVAA  180
NGKQQRFCQQ CSRFHVLTEF DEAKRSCRKR LAEHNRRRRK PASSSTTATS KDSAPPSKKP  240
NPGAISGSSA ADNNTLSATK STISSNTSAI SCLQQHN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301472201184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203220KRSCRKRLAEHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478860.0KF447886.1 Triticum aestivum squamosa promoter-binding-like protein 22 (SPL22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-113PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-83SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-83SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLM0VKE50.0M0VKE5_HORVD; Uncharacterized protein
STRINGMLOC_326.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.18e-44squamosa promoter binding protein-like 8